| Edit |   |
| Antigenic Specificity | CHCHD3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CHCHD3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CHCHD3. This antibody reacts with human. The CHCHD3 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to CHCHD3(coiled-coil-helix-coiled-coil-helix domain containing 3) The peptide sequence was selected from the middle region of CHCHD3. Peptide sequence LRERICSEEERAKAKHLARQLEEKDRVLKKQDAFYKEQLARLEERSSEFY. |
| Other Names | coiled-coil-helix-coiled-coil-helix domain containing 3, FLJ20420, mitochondrial |
| Gene, Accession # | CHCHD3, Gene ID: 54927, Accession: Q9NX63, SwissProt: Q9NX63 |
| Catalog # | NBP1-56871 |
| Price | |
| Order / More Info | CHCHD3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |