| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CHCHD4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CHCHD4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CHCHD4. This antibody reacts with human. The CHCHD4 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human CHCHD4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ELVADDPNDPYEEHGLILPNGNINWNCPCLGGMASGPCGEQFKSAFSCFHYSTEEIKGSDCVDQFRAMQECMQKYPDL |
|---|
| Other Names | CHDH4, coiled-coil-helix-coiled-coil-helix domain containing 4, Coiled-coil-helix-coiled-coil-helix domain-containing protein 4, FLJ31709, MIA40mitochondrial intermembrane space import and assembly protein 40, mitochondrial intermembrane space import and assembly 40 homolog, TIMM40, translocase of inner mitochondrial membrane 40 homolog |
|---|
| Gene, Accession # | CHCHD4, Gene ID: 131474 |
|---|
| Catalog # | NBP1-83537 |
|---|
| Price | |
|---|
| Order / More Info | CHCHD4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|