| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | GFR alpha-2/GDNF R alpha-2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The GFR alpha-2/GDNF R alpha-2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to GFR alpha-2/GDNF R alpha-2. This antibody reacts with human. The GFR alpha-2/GDNF R alpha-2 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the C terminal of human GFRA2. Peptide sequence NVSPKGPSFQATQAPRVEKTPSLPDDLSDSTSLGTSVITTCTSVQEQGLK. |
|---|
| Other Names | GDNF family receptor alpha 2, GDNF family receptor alpha-2, GDNF receptor alpha-2, GDNF receptor beta, GDNFR-alpha-2, GDNFR-beta, GDNFRBRET ligand 2, GFR-alpha 2, GFR-alpha-2, glial cell line derived neurotrophic factor receptor, beta, Neurturin receptor alpha, NRTNR-alpha, NTNRA, NTNR-alpha, PI-linked cell-surface accessory protein, RETL2TGF-beta-related neurotrophic factor receptor 2, TGF-beta related neurotrophic factor receptor 2, TRN receptor, GPI-anchored, TRNR2NRTNR-ALPHA |
|---|
| Gene, Accession # | GFRA2, Gene ID: 2675, Accession: NP_001486, SwissProt: NP_001486 |
|---|
| Catalog # | NBP1-79553-20ul |
|---|
| Price | |
|---|
| Order / More Info | GFR alpha-2/GDNF R alpha-2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|