| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | HLA DQA1 |
|---|
| Clone | 1A3 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Proximity Ligation Assay. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The HLA DQA1 Antibody (1A3) from Novus Biologicals is a mouse monoclonal antibody to HLA DQA1. This antibody reacts with human. The HLA DQA1 Antibody (1A3) has been validated for the following applications: Western Blot, ELISA, Proximity Ligation Assay. |
|---|
| Immunogen | HLA-DQA1 (NP_002113.2, 24 a.a. - 110 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EDIVADHVASCGVNLYQFYGPSGQYTHEFDGDEEFYVDLERKETAWRWPEFSKFGGFDPQGALRNMAVAKHNLNIMIKRYNSTAATN |
|---|
| Other Names | CD, CELIAC1DQ alpha 1 chain, DC-1 alpha chain, DQ-A1, FLJ27088, FLJ27328, GSE, HLA class II histocompatibility antigen, DQ(W3) alpha chain, HLA-DCA, HLA-DQA, leucocyte antigen DQA1, leukocyte antigen alpha chain, major histocompatibility complex, class II, DQ alpha 1, MGC149527, MHC class II antigen, MHC class II DQA1, MHC class II HLA-D alpha glycoprotein, MHC class II HLA-DQ-alpha-1, MHC class II surface glycoprotein, MHC HLA-DQ alpha |
|---|
| Gene, Accession # | HLA-DQA1, Gene ID: 3117, Accession: NP_002113, SwissProt: NP_002113 |
|---|
| Catalog # | H00003117-M01 |
|---|
| Price | |
|---|
| Order / More Info | HLA DQA1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|