| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TUG |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TUG Antibody from Novus Biologicals is a rabbit polyclonal antibody to TUG. This antibody reacts with human. The TUG Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human TUG antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GSSASAGQAAASAPLPLESGELSRGDLSRPEDADTSGPCCEHTQEKQSTRAPAAAPFVPFSGGGQRLGGPPGPTRPLTSSS |
|---|
| Other Names | Alveolar soft part sarcoma chromosomal region candidate gene 1 protein, alveolar soft part sarcoma chromosome region, candidate 1, Alveolar soft part sarcoma locus, ASPLUBX domain-containing protein 9, ASPSrenal cell carcinoma gene on chromosome 17, RCC17renal cell carcinoma, papillary, 17, Renal papillary cell carcinoma protein 17, tether containing UBX domain for GLUT4, TUG, UBX domain protein 9, UBXD9ASPCR1, UBXN9FLJ45380 |
|---|
| Gene, Accession # | ASPSCR1, Gene ID: 79058 |
|---|
| Catalog # | NBP1-90079 |
|---|
| Price | |
|---|
| Order / More Info | TUG Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|