| Edit |   |
|---|
| Antigenic Specificity | DPPA2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DPPA2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DPPA2. This antibody reacts with human. The DPPA2 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to DPPA2(developmental pluripotency associated 2) The peptide sequence was selected from the N terminal of DPPA2. Peptide sequence NMEQMEPSVSSTSDVKLEKPKKYNPGHLLQTNEQFTAPQKARCKIPALPL. |
|---|
| Other Names | CT100, developmental pluripotency associated 2, developmental pluripotency-associated protein 2, PESCRG1cancer/testis antigen 100, Pluripotent embryonic stem cell-related gene 1 protein |
|---|
| Gene, Accession # | DPPA2, Gene ID: 151871, Accession: Q7Z7J5, SwissProt: Q7Z7J5 |
|---|
| Catalog # | NBP1-54631-20ul |
|---|
| Price | |
|---|
| Order / More Info | DPPA2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|