| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NEK3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NEK3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NEK3. This antibody reacts with human. The NEK3 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human NEK3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RGGSVIKYSKNTTRKQWLKETPDTLLNILKNADLSLAFQTYTIYRPGSEG FLKGPLSEETEASDSVDGGHDSVILDPERLEPGLDEED |
|---|
| Other Names | EC 2.7.11, EC 2.7.11.1, glycogen synthase A kinase, HSPK 36, HSPK36, hydroxyalkyl-protein kinase, MGC29949, Never in mitosis A-related kinase 3, NIMA (never in mitosis gene a)-related kinase 3, NimA-related protein kinase 3, phosphorylase B kinase kinase, serine/threonine-protein kinase Nek3 |
|---|
| Gene, Accession # | NEK3, Gene ID: 4752 |
|---|
| Catalog # | NBP2-13650 |
|---|
| Price | |
|---|
| Order / More Info | NEK3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|