| 产品详情 |
| Edit |   |
| Antigenic Specificity | NEK4 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | Protein A purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Immunocytochemistry/Immunofluorescence. Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100 |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The NEK4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NEK4. This antibody reacts with human. The NEK4 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: YGEGKGQTNEINALVQLMTQTLKLDSKESCEDVPVANPVSEFKLHRKYRDTLILHGKVAEEAEEIHFKELPSAIMPGSEKIRRLVEVLRTDVIRG |
| Other Names | EC 2.7.11, Never in mitosis A-related kinase 4, NIMA (never in mitosis gene a)-related kinase 4, NimA-related protein kinase 4, NRK2EC 2.7.11.1, pp12301, serine/threonine kinase 2, serine/threonine protein kinase-2, Serine/threonine-protein kinase 2, serine/threonine-protein kinase Nek4, Serine/threonine-protein kinase NRK2, STK2MGC33171 |
| Gene, Accession # | NEK4, Gene ID: 6787 |
| Catalog # | NBP2-68741 |
| Price | |
| Order / More Info | NEK4 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|