| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NKX2.5 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NKX2.5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NKX2.5. This antibody reacts with human. The NKX2.5 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human NKX2 |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LNPYGYNAYPAYPGYGGAACSPGYSCTAAYPAGPSPAQPATAAANNNFVNFGVGDLNAVQSPGIPQSNSGVSTLHGIRA |
|---|
| Other Names | cardiac-specific homeo box, Cardiac-specific homeobox, cardiac-specific homeobox 1, CHNG5, CSX1, CSXFLJ97195, FLJ52202, FLJ99536, Homeobox protein CSX, Homeobox protein NK-2 homolog E, homeobox protein Nkx-2.5, NK2 transcription factor related, locus 5 (Drosophila), NKX2.5FLJ97166, NKX2EFLJ97197, NKX4-1, tinman paralog |
|---|
| Gene, Accession # | NKX2-5, Gene ID: 1482 |
|---|
| Catalog # | NBP2-57744 |
|---|
| Price | |
|---|
| Order / More Info | NKX2.5 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|