| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NKX2.8 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NKX2.8 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NKX2.8. This antibody reacts with human. The NKX2.8 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human NKX2 |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: TSGRLSFTVRSLLDLPEQDAQHLPRREPEPRAPQPDPCAAWLDSERGHYPSSDESSLETSPPDSSQR |
|---|
| Other Names | Homeobox protein NK-2 homolog H, homeobox protein Nkx-2.8, NK2 homeobox 8, NK-2 homolog H (Drosophila), NK2 transcription factor related, locus 8, NK2 transcription factor related, locus 8 (Drosophila), NKX-2.8, NKX2.8NK-2 homolog 8, Nkx2-9, NKX2G, NKX2HNK-2 homolog H |
|---|
| Gene, Accession # | NKX2-8, Gene ID: 26257, Accession: O15522, SwissProt: O15522 |
|---|
| Catalog # | NBP2-34150 |
|---|
| Price | |
|---|
| Order / More Info | NKX2.8 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|