| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NKX3.1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NKX3.1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NKX3.1. This antibody reacts with human. The NKX3.1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: MLRVPEPRPGEAKAEGAAPPTPSKPLTSFLIQDILRDG |
|---|
| Other Names | BAPX2homeobox protein Nkx-3.1, Homeobox protein NK-3 homolog A, NK homeobox (Drosophila), family 3, A, NK3 homeobox 1, NK3 transcription factor homolog A, NK3 transcription factor related, locus 1, NK3 transcription factor related, locus 1 (Drosophila), NKX3.1NKX3, NKX3ANK homeobox, family 3, A |
|---|
| Gene, Accession # | NKX3-1, Gene ID: 4824 |
|---|
| Catalog # | NBP2-62726 |
|---|
| Price | |
|---|
| Order / More Info | NKX3.1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|