| 产品详情 |
| Edit |   |
| Antigenic Specificity | CIAPIN1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CIAPIN1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CIAPIN1. This antibody reacts with human. The CIAPIN1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human CIAPIN1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FGISAGQFVAVVWDKSSPVEALKGLVDKLQALTGNEGRVSVENIKQLLQSAHKESSFDIILSGLVPGSTTLHSAEILAEIARILRPGGCL |
| Other Names | Anamorsin, cytokine induced apoptosis inhibitor 1, Cytokine-induced apoptosis inhibitor 1, DRE2, Fe-S cluster assembly protein DRE2 homolog, predicted protein of HQ0915,2810413N20Rik, PRO0915 |
| Gene, Accession # | CIAPIN1, Gene ID: 57019 |
| Catalog # | NBP1-89097 |
| Price | |
| Order / More Info | CIAPIN1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 23435261, 25889687 |
| 产品资料 |
|
|