| Edit |   |
|---|
| Antigenic Specificity | STAP1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, horse, rabbit, yeast |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-STAP1 Antibody |
|---|
| Immunogen | The immunogen for Anti-STAP1 antibody is: synthetic peptide directed towards the middle region of Human STAP1. Synthetic peptide located within the following region: TELSVPQNVSLLPGQVIKLHEVLEREKKRRIETEQSTSVEKEKEPTEDYV |
|---|
| Other Names | BRDG1, STAP1, signal transducing adaptor family member 1 |
|---|
| Gene, Accession # | STAP1, Accession: NM_012108 |
|---|
| Catalog # | TA331361 |
|---|
| Price | |
|---|
| Order / More Info | STAP1 Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|