| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | GPR154 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval method is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The GPR154 Antibody from Novus Biologicals is a rabbit polyclonal antibody to GPR154. This antibody reacts with human. The GPR154 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human GPR154 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: DILDNFNLLPDTQERFYASVIIQNLPALNSAINPLIYCVFSSSISFPCRERRSQDSRMTFRERTERHEMQILSKP |
|---|
| Other Names | G protein-coupled receptor 154, G protein-coupled receptor for asthma susceptibility, GPR154NPSR, GPRAASRT2, G-protein coupled receptor 154, G-protein coupled receptor for asthma susceptibility, G-protein coupled receptor PGR14, neuropeptide S receptor, neuropeptide S receptor 1, PGR14VRR1, vasopressin receptor-related receptor 1 |
|---|
| Gene, Accession # | NPSR1, Gene ID: 387129, Accession: Q6W5P4, SwissProt: Q6W5P4 |
|---|
| Catalog # | NBP1-91966 |
|---|
| Price | |
|---|
| Order / More Info | GPR154 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 19732772 |
|---|
| 产品资料 |
|
|