| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | GPR154 |
|---|
| Clone | 2F5 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG1 kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The GPR154 Antibody (2F5) from Novus Biologicals is a mouse monoclonal antibody to GPR154. This antibody reacts with human. The GPR154 Antibody (2F5) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | GPR154 (NP_997056, 2 a.a. 53 a.a) partial recombinant protein with GST tag. PANFTEGSFDSSGTGQTLDSSPVACTETVTFTEVVEGKEWGSFYYSFKTEQL |
|---|
| Other Names | G protein-coupled receptor 154, G protein-coupled receptor for asthma susceptibility, GPR154NPSR, GPRAASRT2, G-protein coupled receptor 154, G-protein coupled receptor for asthma susceptibility, G-protein coupled receptor PGR14, neuropeptide S receptor, neuropeptide S receptor 1, PGR14VRR1, vasopressin receptor-related receptor 1 |
|---|
| Gene, Accession # | NPSR1, Gene ID: 387129, Accession: NP_997056, SwissProt: NP_997056 |
|---|
| Catalog # | H00387129-M01 |
|---|
| Price | |
|---|
| Order / More Info | GPR154 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|