| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CACNB2 |
|---|
| Clone | 6C1 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | IgG1 kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CACNB2 Antibody (6C1) from Novus Biologicals is a mouse monoclonal antibody to CACNB2. This antibody reacts with human, mouse, rat. The CACNB2 Antibody (6C1) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | CACNB2 (NP_963890 213 a.a. - 301 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PSSRKSTPPSSAIDIDATGLDAEENDIPANHRSPKPSANSVTSPHSKEKRMPFFKKTEHTPPYDVVPSMRPVVLVGPSLKGYEVTDMMQ |
|---|
| Other Names | CAB2, CACNLB2, Calcium channel voltage-dependent subunit beta 2, calcium channel, voltage-dependent, beta 2 subunit, CAVB2, FLJ23743, Lambert-Eaton myasthenic syndrome antigen B, myasthenic (Lambert-Eaton) syndrome antigen B, MYSB, voltage-dependent L-type calcium channel subunit beta-2 |
|---|
| Gene, Accession # | CACNB2, Gene ID: 783, Accession: NP_963890, SwissProt: NP_963890 |
|---|
| Catalog # | H00000783-M01 |
|---|
| Price | |
|---|
| Order / More Info | CACNB2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|