| Edit |   |
| Antigenic Specificity | PBX3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100ug |
| Concentration | n/a |
| Applications | WB,IHC |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-PBX3 Antibody |
| Immunogen | The immunogen for anti-PBX3 antibody: synthetic peptide directed towards the N terminal of human PBX3. Synthetic peptide located within the following region: SRMLQTLAGVNLAGHSVQGGMALPPPPHGHEGADGDGRKQDIGDILHQIM |
| Other Names | pre-B-cell leukemia homeobox 3 |
| Gene, Accession # | PBX3, Accession: NM_001134778 |
| Catalog # | TA329893 |
| Price | |
| Order / More Info | PBX3 Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |