| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MIS12 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MIS12 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MIS12. This antibody reacts with human. The MIS12 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human MIS12 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KEIEQLQEKYKTELCTKQALLAELEEQKIVQAKLKQTLTFFDELHNVGRDHGTSDFRESLVSLVQNSRKLQNIRDNVEKESKRLKI |
|---|
| Other Names | 2510025F08Rik, hMis12, homolog of yeast Mis12, KNTC2AP, MGC2488, MIS12 homolog, MIS12, MIND kinetochore complex component, homolog (S. pombe), MIS12, MIND kinetochore complex component, homolog (yeast), MTW1, protein MIS12 homolog |
|---|
| Gene, Accession # | MIS12, Gene ID: 79003 |
|---|
| Catalog # | NBP1-92118 |
|---|
| Price | |
|---|
| Order / More Info | MIS12 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|