| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PIN/DLC8 |
|---|
| Clone | 1H7 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PIN/DLC8 Antibody (1H7) from Novus Biologicals is a mouse monoclonal antibody to PIN/DLC8. This antibody reacts with human. The PIN/DLC8 Antibody (1H7) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. |
|---|
| Immunogen | DYNLL1 (NP_003737.1, 1 a.a. - 72 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKH |
|---|
| Other Names | cytoplasmic dynein light polypeptide, DLC1DNCLC1, DLC8MGC126137, DNCL1MGC126138, dynein light chain 1, cytoplasmic, Dynein light chain LC8-type 1, dynein, cytoplasmic, light polypeptide 1, dynein, light chain, LC8-type 1,8 kDa dynein light chain, hdlc1, LC8, PINLC8a, Protein inhibitor of neuronal nitric oxide synthase |
|---|
| Gene, Accession # | DYNLL1, Gene ID: 8655, Accession: NP_003737, SwissProt: NP_003737 |
|---|
| Catalog # | H00008655-M02 |
|---|
| Price | |
|---|
| Order / More Info | PIN/DLC8 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|