| Edit |   |
| Antigenic Specificity | ATF5 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal anti-ATF5 Antibody |
| Immunogen | The immunogen for Anti-ATF5 antibody is: synthetic peptide directed towards the N-terminal region of Human ATF5. Synthetic peptide located within the following region: MASLLKKELEQMEDFFLDAPPLPPPSPPPLPPPPLPPAPSLPLSLPSFDL |
| Other Names | ATFX, HMFN0395, activating transcription factor 5 |
| Gene, Accession # | ATF5, Accession: NM_012068 |
| Catalog # | TA329199 |
| Price | |
| Order / More Info | ATF5 Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |