| Edit |   |
|---|
| Antigenic Specificity | WDR21B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The WDR21B Antibody from Novus Biologicals is a rabbit polyclonal antibody to WDR21B. This antibody reacts with human. The WDR21B Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to WDR21B(WD repeat domain 21B) The peptide sequence was selected from the middle region of WDR21B. Peptide sequence HEEEGIVVAVGQDCYTRIWSLHDAHLLRTIPSPYSASEDDIPSVAFASRL. |
|---|
| Other Names | DDB1 and CUL4 associated factor 4-like 1 |
|---|
| Gene, Accession # | DCAF4L1, Gene ID: 285429 |
|---|
| Catalog # | NBP1-70743 |
|---|
| Price | |
|---|
| Order / More Info | WDR21B Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|