| Edit |   |
|---|
| Antigenic Specificity | WDR45L |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The WDR45L Antibody from Novus Biologicals is a rabbit polyclonal antibody to WDR45L. This antibody reacts with rat. The WDR45L Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide towards Wdr45l. Peptide sequence YLALVGGGKKPKYPPNKVMIWDDLKKKTVIEIEFSTEVKAVKLRRDRIVV. |
|---|
| Other Names | WDR45-like, WDR45-like protein, WIPI3 |
|---|
| Gene, Accession # | WDR45L, Gene ID: 56270, Accession: NP_001034676 |
|---|
| Catalog # | NBP1-82387-20ul |
|---|
| Price | |
|---|
| Order / More Info | WDR45L Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|