| Edit |   |
| Antigenic Specificity | WDR45L |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | rat |
| Isotype | n/a |
| Format | immunogen affinity purified, no preservative |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The WDR45L Antibody from Novus Biologicals is a rabbit polyclonal antibody to WDR45L. This antibody reacts with rat. The WDR45L Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide towards Wdr45l. Peptide sequence YLALVGGGKKPKYPPNKVMIWDDLKKKTVIEIEFSTEVKAVKLRRDRIVV. |
| Other Names | WDR45-like, WDR45-like protein, WIPI3 |
| Gene, Accession # | WDR45L, Gene ID: 56270, Accession: NP_001034676 |
| Catalog # | NBP1-82387 |
| Price | |
| Order / More Info | WDR45L Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |