| Edit |   |
| Antigenic Specificity | WDR83OS |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The WDR83OS Antibody from Novus Biologicals is a rabbit polyclonal antibody to WDR83OS. This antibody reacts with human. The WDR83OS Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to C19ORF56 The peptide sequence was selected from the N terminal of C19ORF56. Peptide sequence STNNMSDPRRPNKVLRYKPPPSECNPALDDPTPDYMNLLGMIFSMCGLML. |
| Other Names | C19orf56, chromosome 19 open reading frame 56, hypothetical protein LOC51398, PTD008, WD repeat domain 83 opposite strand |
| Gene, Accession # | WDR83OS, Gene ID: 51398, Accession: Q9Y284, SwissProt: Q9Y284 |
| Catalog # | NBP1-59969-20ul |
| Price | |
| Order / More Info | WDR83OS Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |