| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MARCH6 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MARCH6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MARCH6. This antibody reacts with human. The MARCH6 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human MARCH6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: HTRQWLKGLVRAWTVTAGYLLDLHSYLLGDQEENENSANQQVNNNQHARNNNAIPVVGEGLHAAHQAILQQGGPVGFQPYRRPLN |
|---|
| Other Names | E3 ubiquitin-protein ligase MARCH6, EC 6.3.2.-, MARCH-VIDOA10, membrane-associated ring finger (C3HC4) 6, Membrane-associated RING finger protein 6, Membrane-associated RING-CH protein VI, Protein TEB-4, RNF176KIAA0597Doa10 homolog, TEB4RING finger protein 176 |
|---|
| Gene, Accession # | MARCH6, Gene ID: 10299 |
|---|
| Catalog # | NBP2-58931 |
|---|
| Price | |
|---|
| Order / More Info | MARCH6 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|