| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MARCKS |
|---|
| Clone | 2H4 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | IgG1 kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MARCKS Antibody (2H4) from Novus Biologicals is a mouse monoclonal antibody to MARCKS. This antibody reacts with human, mouse. The MARCKS Antibody (2H4) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | MARCKS (NP_002347, 2 a.a. - 65 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GAQFSKTAAKGEAAAERPGEAAVASSPSKANGQENGHVKVNGDASPAAAESGAKEELQANGSAP |
|---|
| Other Names | 80K-L, 80K-L protein, FLJ14368, MACSmyristoylated alanine-rich C-kinase substrate, MRACKS, myristoylated alanine-rich protein kinase C substrate, myristoylated alanine-rich protein kinase C substrate (MARCKS, 80K-L), phosphomyristin, PKCSLFLJ90045, PRKCSL, Protein kinase C substrate, 80 kDa protein, light chain |
|---|
| Gene, Accession # | MARCKS, Gene ID: 4082, Accession: NP_002347, SwissProt: NP_002347 |
|---|
| Catalog # | H00004082-M04 |
|---|
| Price | |
|---|
| Order / More Info | MARCKS Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|