| Edit |   |
|---|
| Antigenic Specificity | MARCO |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. IHC reported in a verified customer review. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MARCO Antibody from Novus Biologicals is a rabbit polyclonal antibody to MARCO. This antibody reacts with human. The MARCO Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human MARCO antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LNLQARLRVLEMYFLNDTLAAEDSPSFSLLQSAHPGEHLAQGASRLQVLQAQLTWVRV |
|---|
| Other Names | macrophage receptor with collagenous structureSCARA2Scavenger receptor class A member 2, member 2 |
|---|
| Gene, Accession # | MARCO, Gene ID: 8685, Accession: Q9UEW3, SwissProt: Q9UEW3 |
|---|
| Catalog # | NBP2-39004 |
|---|
| Price | |
|---|
| Order / More Info | MARCO Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|