| Edit |   |
|---|
| Antigenic Specificity | MARCO |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MARCO Antibody from Novus Biologicals is a rabbit polyclonal antibody to MARCO. This antibody reacts with human. The MARCO Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to MARCO(macrophage receptor with collagenous structure) The peptide sequence was selected from the N terminal of MARCO. Peptide sequence QARLRVLEMYFLNDTLAAEDSPSFSLLQSAHPGEHLAQGASRLQVLQAQL. |
|---|
| Other Names | macrophage receptor with collagenous structureSCARA2Scavenger receptor class A member 2, member 2 |
|---|
| Gene, Accession # | MARCO, Gene ID: 8685, Accession: Q9UEW3, SwissProt: Q9UEW3 |
|---|
| Catalog # | NBP1-59543-20ul |
|---|
| Price | |
|---|
| Order / More Info | MARCO Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|