| Edit |   |
| Antigenic Specificity | MARCO |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified, no preservative |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The MARCO Antibody from Novus Biologicals is a rabbit polyclonal antibody to MARCO. This antibody reacts with human. The MARCO Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to MARCO(macrophage receptor with collagenous structure) The peptide sequence was selected from the N terminal of MARCO. Peptide sequence QARLRVLEMYFLNDTLAAEDSPSFSLLQSAHPGEHLAQGASRLQVLQAQL. |
| Other Names | macrophage receptor with collagenous structureSCARA2Scavenger receptor class A member 2, member 2 |
| Gene, Accession # | MARCO, Gene ID: 8685, Accession: Q9UEW3, SwissProt: Q9UEW3 |
| Catalog # | NBP1-59543 |
| Price | |
| Order / More Info | MARCO Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |