| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | DNA Primase large subunit |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DNA Primase large subunit Antibody from Novus Biologicals is a rabbit polyclonal antibody to DNA Primase large subunit. This antibody reacts with human. The DNA Primase large subunit Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human DNA Primase large subunit antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ASYPHCLQFYLQPPSENISLIEFENLAIDRVKLLKSVENLGVSYVKGTEQYQSKLESELRKLKFSYRENLEDEYEPRRR |
|---|
| Other Names | dJ422B11.1.1, DNA primase 58 kDa subunit, DNA primase subunit p58, EC 2.7.7, EC 2.7.7.-, MGC75142, p58, polypeptide 2A, p58, PRIM2ADNA primase large subunit, primase polypeptide 2A, 58kDa, primase, DNA, polypeptide 2 (58kDa), primase, polypeptide 2A (58kD), primase, polypeptide 2A, 58kDa |
|---|
| Gene, Accession # | PRIM2, Gene ID: 5558 |
|---|
| Catalog # | NBP2-58498 |
|---|
| Price | |
|---|
| Order / More Info | DNA Primase large subunit Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|