| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | RED2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RED2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RED2. This antibody reacts with human, mouse. The RED2 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to ADARB2(adenosine deaminase, RNA-specific, B2 (RED2 homolog rat)) The peptide sequence was selected from the middle region of ADARB2 (NP_061172). Peptide sequence: SYRHNRPLLSGVSDAEARQPGKSPPFSMNWVVGSADLEIINATTGRRSCG. |
|---|
| Other Names | ADAR3adenosine deaminase, RNA-specific, B2 (RED1 homolog rat), adenosine deaminase, RNA-specific, B2, adenosine deaminase, RNA-specific, B2 (RED2 homolog rat), double-stranded RNA-specific editase B2, dsRNA adenosine deaminase B2, EC 3.5, EC 3.5.1.2, EC 3.5.4, FLJ25034, homolog of rat BLUE, hRED2, RED2 homolog, RED2FLJ36975, RNA-dependent adenosine deaminase 3, RNA-editing deaminase 2, RNA-editing enzyme 2 |
|---|
| Gene, Accession # | ADARB2, Gene ID: 105, Accession: Q9NS39, SwissProt: Q9NS39 |
|---|
| Catalog # | NBP1-57558 |
|---|
| Price | |
|---|
| Order / More Info | RED2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 29719497 |
|---|
| 产品资料 |
|
|