| 产品详情 |
| Edit |   |
| Antigenic Specificity | non-muscle Myosin IIA |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | Protein A purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The non-muscle Myosin IIA Antibody from Novus Biologicals is a rabbit polyclonal antibody to non-muscle Myosin IIA. This antibody reacts with human. The non-muscle Myosin IIA Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LEDATETADAMNREVSSLKNKLRRGDLPFVVPRRMARKGAGDGSDEEVDGKADGAEAKPA |
| Other Names | Cellular myosin heavy chain, type A, DFNA17, EPSTS, FTNSNMMHC-IIA, MGC104539, MHANMMHC II-a, MYH9 variant protein, Myosin heavy chain 9, Myosin heavy chain, non-muscle IIa, myosin, heavy chain 9, non-muscle, myosin, heavy polypeptide 9, non-muscle, myosin-9, NMHC-II-A, NMMHCA, NMMHC-A, Non-muscle myosin heavy chain A, nonmuscle myosin heavy chain II-A, Non-muscle myosin heavy chain IIa, non-muscle myosin heavy polypeptide 9 |
| Gene, Accession # | MYH9, Gene ID: 4627 |
| Catalog # | NBP2-62644 |
| Price | |
| Order / More Info | non-muscle Myosin IIA Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|