| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | non-muscle Myosin IIA |
|---|
| Clone | 4H3 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2b kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Antibody reactivity against recombinant protein for WB. It has been used for IHC-P and ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The non-muscle Myosin IIA Antibody (4H3) from Novus Biologicals is a mouse monoclonal antibody to non-muscle Myosin IIA. This antibody reacts with human. The non-muscle Myosin IIA Antibody (4H3) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | MYH9 (AAH11915, 131 a.a. - 220 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RLKQLKRQLEEAEEEAQRANASRRKLQRELEDATETADAMNREVSSLKNKLRRGDLPFVVPRRMARKGAGDGSDEEVDGKADGAEAKPAE |
|---|
| Other Names | Cellular myosin heavy chain, type A, DFNA17, EPSTS, FTNSNMMHC-IIA, MGC104539, MHANMMHC II-a, MYH9 variant protein, Myosin heavy chain 9, Myosin heavy chain, non-muscle IIa, myosin, heavy chain 9, non-muscle, myosin, heavy polypeptide 9, non-muscle, myosin-9, NMHC-II-A, NMMHCA, NMMHC-A, Non-muscle myosin heavy chain A, nonmuscle myosin heavy chain II-A, Non-muscle myosin heavy chain IIa, non-muscle myosin heavy polypeptide 9 |
|---|
| Gene, Accession # | MYH9, Gene ID: 4627 |
|---|
| Catalog # | H00004627-M06 |
|---|
| Price | |
|---|
| Order / More Info | non-muscle Myosin IIA Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 21316371, 22366308 |
|---|
| 产品资料 |
|
|