| 产品详情 |
| Edit |   |
| Antigenic Specificity | non-muscle Myosin IIA |
| Clone | 3C7 |
| Host Species | Mouse |
| Reactive Species | human, mouse |
| Isotype | IgG2b kappa |
| Format | ascites, no preservative |
| Size | 50 ug |
| Concentration | n/a |
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. It has been used for ELISA, WB and IF. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The non-muscle Myosin IIA Antibody (3C7) from Novus Biologicals is a mouse monoclonal antibody to non-muscle Myosin IIA. This antibody reacts with human, mouse. The non-muscle Myosin IIA Antibody (3C7) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. |
| Immunogen | MYH9 (AAH11915, 131 a.a. - 220 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RLKQLKRQLEEAEEEAQRANASRRKLQRELEDATETADAMNREVSSLKNKLRRGDLPFVVPRRMARKGAGDGSDEEVDGKADGAEAKPAE |
| Other Names | Cellular myosin heavy chain, type A, DFNA17, EPSTS, FTNSNMMHC-IIA, MGC104539, MHANMMHC II-a, MYH9 variant protein, Myosin heavy chain 9, Myosin heavy chain, non-muscle IIa, myosin, heavy chain 9, non-muscle, myosin, heavy polypeptide 9, non-muscle, myosin-9, NMHC-II-A, NMMHCA, NMMHC-A, Non-muscle myosin heavy chain A, nonmuscle myosin heavy chain II-A, Non-muscle myosin heavy chain IIa, non-muscle myosin heavy polypeptide 9 |
| Gene, Accession # | MYH9, Gene ID: 4627 |
| Catalog # | H00004627-M01 |
| Price | |
| Order / More Info | non-muscle Myosin IIA Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 28814668 |
| 产品资料 |
|
|