| Edit |   |
|---|
| Antigenic Specificity | SHCBP1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, porcine, rabbit, bovine |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-SHCBP1 Antibody |
|---|
| Immunogen | The immunogen for Anti-SHCBP1 antibody is: synthetic peptide directed towards the C-terminal region of Human SHCBP1. Synthetic peptide located within the following region: IPKISMVNNIIHNNEGYGVVLVKPTIFSDLQENAEDGTEENKALKIQTSG |
|---|
| Other Names | PAL, SHC SH2-domain binding protein 1 |
|---|
| Gene, Accession # | SHCBP, Accession: NM_024745 |
|---|
| Catalog # | TA330750 |
|---|
| Price | |
|---|
| Order / More Info | SHCBP1 Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|