| Edit |   |
| Antigenic Specificity | ACTL9 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ACTL9 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ACTL9. This antibody reacts with human. The ACTL9 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to MGC33407(hypothetical protein MGC33407) The peptide sequence was selected from the middle region of MGC33407. Peptide sequence DHPLLFSDPPFSPATNREKLVEVAFESLRSPAMYVASQSVLSVYAHGRVS. |
| Other Names | actin-like 9, actin-like protein 9, ACTL7C, MGC33407 |
| Gene, Accession # | ACTL9, Gene ID: 284382, Accession: Q8TC94, SwissProt: Q8TC94 |
| Catalog # | NBP1-56907-20ul |
| Price | |
| Order / More Info | ACTL9 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |