| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | IZUMO4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The IZUMO4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to IZUMO4. This antibody reacts with human. The IZUMO4 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human IZUMO4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: RCGIFQYETISCNNCTDSHVACFGYNCESSAQWKSAVQGLLNYINNWHKQDTSMSLVSPALRCLEPPHLANLTLEDAAEC |
|---|
| Other Names | C19orf36, chromosome 19 open reading frame 36, IMAGE:4215339, IZUMO family member 4, izumo sperm-egg fusion protein 4, putative SAMP14 binding protein variant 1, putative SAMP14 binding protein variant 2, Sperm 22 kDa protein c113 |
|---|
| Gene, Accession # | IZUMO4, Gene ID: 113177, Accession: Q1ZYL8, SwissProt: Q1ZYL8 |
|---|
| Catalog # | NBP2-30881 |
|---|
| Price | |
|---|
| Order / More Info | IZUMO4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|