| 产品详情 |
| Edit |   |
| Antigenic Specificity | P15RS |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The P15RS Antibody from Novus Biologicals is a rabbit polyclonal antibody to P15RS. This antibody reacts with human, mouse, rat. The P15RS Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat P15RS antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VIVEAFKHVSSETDESCKKHLGRVLSIWEERSVYENDVLEQLKQALYGDKKPRKRTYEQIKVDENENCSSLGSPSEPPQTL |
| Other Names | Cyclin-dependent kinase inhibitor 2B-related protein, Cyclin-dependent kinase inhibitor 2B-related protein (p15INK4B-related protein), FLJ10656, HsT3101, MGC19513, p15INK4B-related protein, P15RScyclin-dependent kinase 2B-inhibitor-related protein, regulation of nuclear pre-mRNA domain containing 1A, regulation of nuclear pre-mRNA domain-containing protein 1A |
| Gene, Accession # | RPRD1A, Gene ID: 55197 |
| Catalog # | NBP1-87917 |
| Price | |
| Order / More Info | P15RS Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 22002106 |
| 产品资料 |
|
|