| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | BHLHA9 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The BHLHA9 Antibody from Novus Biologicals is a rabbit polyclonal antibody to BHLHA9. This antibody reacts with human. The BHLHA9 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human BHLHA9 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SKARRMAANVRERKRILDYNEAFNALRRALRHDLGGKRLSKIATLRRAIHRIAALSLVLRASPAPRGPCGHLECHG |
|---|
| Other Names | Basic Helix-Loop-Helix Family, Member A9, bHLHa9, BHLHF42, Class A Basic Helix-Loop-Helix Protein 9, Class F Basic Helix-Loop-Helix Factor 42, Class II Basic Helix-Loop-Helix Protein |
|---|
| Gene, Accession # | BHLHA9, Gene ID: 727857, Accession: Q7RTU4, SwissProt: Q7RTU4 |
|---|
| Catalog # | NBP2-37997 |
|---|
| Price | |
|---|
| Order / More Info | BHLHA9 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|