| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | BHLHB5 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The BHLHB5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to BHLHB5. This antibody reacts with human. The BHLHB5 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human BHLHB5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GLLVGSAGVGGDPSLSSLPAGAALCLKYGESASRGSVAESSGGEQSPDDDSDGRCELVLRAGV |
|---|
| Other Names | Basic Helix-Loop-Helix Domain Containing, Class B, 5, basic helix-loop-helix family, member e22, Beta3, BHLHE22, CAGL85, Class B Basic Helix-Loop-Helix Protein 5, Class E Basic Helix-Loop-Helix Protein 22, TNRC20, Trinucleotide Repeat Containing 20, Trinucleotide Repeat-Containing Gene 20 Protein |
|---|
| Gene, Accession # | BHLHE22, Gene ID: 27319, Accession: Q8NFJ8, SwissProt: Q8NFJ8 |
|---|
| Catalog # | NBP2-39085 |
|---|
| Price | |
|---|
| Order / More Info | BHLHB5 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|