| Edit |   |
|---|
| Antigenic Specificity | DAB2 |
|---|
| Clone | 1C8 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DAB2 Antibody (1C8) from Novus Biologicals is a mouse monoclonal antibody to DAB2. This antibody reacts with human. The DAB2 Antibody (1C8) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | DAB2 (NP_001334 673 a.a. - 770 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QTSSGTLSAFASYFNSKVGIPQENADHDDFDANQLLNKINEPPKPAPRQVSLPVTKSTDNAFENPFFKDSFGSSQASVASSQPVSSEMYRDPFGNPFA |
|---|
| Other Names | Differentially-expressed protein 2, disabled (Drosophila) homolog 2 (mitogen-responsive phosphoprotein), disabled homolog 2, mitogen-responsive phosphoprotein (Drosophila), DOC-2DOC2disabled homolog 2, FLJ26626, mitogen-responsive phosphoprotein |
|---|
| Gene, Accession # | DAB2, Gene ID: 1601, Accession: NP_001334, SwissProt: NP_001334 |
|---|
| Catalog # | H00001601-M06 |
|---|
| Price | |
|---|
| Order / More Info | DAB2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|