| Edit |   |
| Antigenic Specificity | gamma-Glutamylcyclotransferase/CRF21/GGCT |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The gamma-Glutamylcyclotransferase/CRF21/GGCT Antibody from Novus Biologicals is a rabbit polyclonal antibody to gamma-Glutamylcyclotransferase/CRF21/GGCT. This antibody reacts with human. The gamma-Glutamylcyclotransferase/CRF21/GGCT Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human gamma-Glutamylcyclotransferase/CRF21/GGCT antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: NSGCKDVTGPDEESFLYFAYGSNLLTERIHLRNPSAAFFCVARLQDFKLDFGNSQGKTSQTWHGGIATIFQSPGDEVWGVVWKMNKSNLNSLDE |
| Other Names | gamma-glutamylcyclotransferase, GCTG, GGC, MGC3077 |
| Gene, Accession # | GGCT, Gene ID: 79017, Accession: O75223, SwissProt: O75223 |
| Catalog # | NBP1-86727 |
| Price | |
| Order / More Info | gamma-Glutamylcyclotransferase/CRF21/GGCT Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 20527979, 22205682 |