| Edit |   |
|---|
| Antigenic Specificity | Gamma-glutamyltransferase 2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Gamma-glutamyltransferase 2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Gamma-glutamyltransferase 2. This antibody reacts with human. The Gamma-glutamyltransferase 2 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the N terminal of human GGT2. Peptide sequence LEIGRDTLRDGGSAVDAAIAALLCVGLMNAHSMGIGVGLFLTIYNSTTGK. |
|---|
| Other Names | gamma-glutamyltransferase 2, gamma-glutamyltranspeptidase 2 |
|---|
| Gene, Accession # | GGT2, Gene ID: 728441 |
|---|
| Catalog # | NBP1-79312-20ul |
|---|
| Price | |
|---|
| Order / More Info | Gamma-glutamyltransferase 2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|