| 产品详情 |
| Edit |   |
| Antigenic Specificity | Pyruvate Carboxylase |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Pyruvate Carboxylase Antibody from Novus Biologicals is a rabbit polyclonal antibody to Pyruvate Carboxylase. This antibody reacts with human, mouse. The Pyruvate Carboxylase Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Pyruvate Carboxylase antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GADVVDVAADSMSGMTSQPSMGALVACTRGTPLDTEVPMERVFDYSEYWEGARGLYAAFDCTATMKSGNSDVYENEIPGGQYTNLHFQ |
| Other Names | EC 6.4.1, EC 6.4.1.1, PCBPyruvic carboxylase, pyruvate carboxylase, pyruvate carboxylase, mitochondrial |
| Gene, Accession # | PC, Gene ID: 5091, Accession: P11498, SwissProt: P11498 |
| Catalog # | NBP2-33407 |
| Price | |
| Order / More Info | Pyruvate Carboxylase Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 26302408 |
| 产品资料 |
|
|