| Edit |   |
|---|
| Antigenic Specificity | Pyruvate Dehydrogenase E2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Pyruvate Dehydrogenase E2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Pyruvate Dehydrogenase E2. This antibody reacts with human. The Pyruvate Dehydrogenase E2 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to DLAT(dihydrolipoamide S-acetyltransferase) The peptide sequence was selected from the C terminal of DLAT. Peptide sequence DVVSLATKAREGKLQPHEFQGGTFTISNLGMFGIKNFSAIINPPQACILA. |
|---|
| Other Names | 70 kDa mitochondrial autoantigen of primary biliary cirrhosis, dihydrolipoamide S-acetyltransferase, DLTA, E2 component of pyruvate dehydrogenase complex, EC 2.3.1, M2 antigen complex 70 kDa subunit, PBC, PDC-E2EC 2.3.1.12, PDCE2mitochondrial |
|---|
| Gene, Accession # | DLAT, Gene ID: 1737, Accession: Q86YI5, SwissProt: Q86YI5 |
|---|
| Catalog # | NBP1-54756 |
|---|
| Price | |
|---|
| Order / More Info | Pyruvate Dehydrogenase E2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|