| Edit |   |
| Antigenic Specificity | C2orf29 - N-terminal region |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | dog, porcine |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-C2orf29 Antibody - N-terminal region |
| Immunogen | The immunogen for anti-C2orf29 antibody: synthetic peptide directed towards the N terminal of human C2orf29. Synthetic peptide located within the following region: NPFAASFAHLLNPAPPARGGQEPDRPPLSGFLPPITPPEKFFLSQLMLAP |
| Other Names | C2orf29, CCR4-NOT transcription complex, subunit 11 |
| Gene, Accession # | CNOT11, Accession: NM_017546 |
| Catalog # | TA344994 |
| Price | |
| Order / More Info | C2orf29 - N-terminal region Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |