| 产品详情 |
| Edit |   |
| Antigenic Specificity | MCM9 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The MCM9 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MCM9. This antibody reacts with human. The MCM9 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human MCM9 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SPPPERKNRGERGPSSPPTTTAPMRVSKRKSFQLRGSTEKLIVSKESLFTLPELGDEAFDCDWD |
| Other Names | C6orf61, chromosome 6 open reading frame 61, dJ329L24.1, dJ329L24.3, DNA replication licensing factor MCM9, FLJ13942, FLJ20170, FLJ56845, hMCM9, MCMDC1, MGC35304, minichromosome maintenance complex component 9, Mini-chromosome maintenance deficient 9, minichromosome maintenance deficient domain containing 1, Mini-chromosome maintenance deficient domain-containing protein 1 |
| Gene, Accession # | MCM9, Gene ID: 254394 |
| Catalog # | NBP1-86740 |
| Price | |
| Order / More Info | MCM9 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|