| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MCM3AP |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MCM3AP Antibody from Novus Biologicals is a rabbit polyclonal antibody to MCM3AP. This antibody reacts with human. The MCM3AP Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human MCM3AP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RDWYDFVWNRTRGIRKDITQQHLCDPLTVSLIEKCTRFHIHCAHFMCEEPMSSFDAKINNENMTKCLQSLKEMYQDLRNKGVFCASE |
|---|
| Other Names | 80 kDa MCM3-associated protein, FLJ44336, GANPFLJ45306, human mRNA for MCM3 import factor10Protein GANP, KIAA0572MAP80germinal center-associated nuclear protein, Map80, MCM3 import protein, MCM3 minichromosome maintenance deficient 3 (S. cerevisiae) associated protein, MCM3 minichromosome maintenance deficient 3 associated protein, minichromosome maintenance complex component 3 associated protein, minichromosome maintenance deficient (S. cerevisiae) 3-associated protein, minichromosome maintenance deficient 3-associated protein |
|---|
| Gene, Accession # | MCM3AP, Gene ID: 8888 |
|---|
| Catalog # | NBP2-58502 |
|---|
| Price | |
|---|
| Order / More Info | MCM3AP Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|