| Edit |   |
|---|
| Antigenic Specificity | FCRL6 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, rabbit, guinea pig |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-FCRL6 Antibody |
|---|
| Immunogen | The immunogen for anti-FCRL6 antibody is: synthetic peptide directed towards the C-terminal region of Human FCRL6. Synthetic peptide located within the following region: HSAPCGGTTSLLFPVKSEQDAGNYSCEAENSVSRERSEPKKLSLKGSQVL |
|---|
| Other Names | FcRH6, Fc receptor-like 6 |
|---|
| Gene, Accession # | FCRL6, Accession: NM_001004310 |
|---|
| Catalog # | TA335314 |
|---|
| Price | |
|---|
| Order / More Info | FCRL6 Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|