| Edit |   |
|---|
| Antigenic Specificity | CHIC1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CHIC1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CHIC1. This antibody reacts with human. The CHIC1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the N terminal of human CHIC1. Peptide sequence LRRYAPDPVLVRGAGHITVFGLSNKFDTEFPSVLTGKVAPEEFKTSIGRV. |
|---|
| Other Names | cysteine-rich hydrophobic domain 1 |
|---|
| Gene, Accession # | CHIC1, Gene ID: 53344, Accession: NP_001034929, SwissProt: NP_001034929 |
|---|
| Catalog # | NBP1-91589-20ul |
|---|
| Price | |
|---|
| Order / More Info | CHIC1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|